PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00057185-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 547aa    MW: 60161.6 Da    PI: 6.5893
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00057185-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS409.53.1e-125705441373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lLl+cA+ v sg++e+++ +L+++s las +gdpmqRla+yf+e+Laar+++s+++l +al++++ +  + s+ + a+++f+ ++P+lkf
  PSME_00057185-RA  70 LIQLLLACAKYVCSGNMEQTNVCLEQISVLASLTGDPMQRLATYFMEGLAARITKSWPGLHRALNSTHLQ-PSISDLALARQVFFSLFPYLKF 161
                       689*************************************************************999997.47899999************** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       ++ +   +Ile++e+e+ vHiiD+d+s+++QW+++lq+L++Rp+gpp+l++Tg+++    +ke l++t+  L++ Ae+l++pf+fn  +++rl
  PSME_00057185-RA 162 AFNAVHLTILESMEKEKVVHIIDLDASEPAQWIPFLQSLSQRPGGPPHLKMTGIAE----KKEVLQQTAAILTEEAERLDIPFQFNQ-LVTRL 249
                       ********************************************************....9**************************.599** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrll................................................................. 214
                       + l+ ++L+vk+g+a+a++ vlq h ll                                                                 
  PSME_00057185-RA 250 DHLTDDMLAVKTGDAVAISAVLQFHALLaeeqdfdhngggggggggggggvgvgssvpmnrkrprecsntvrhndlilrsmfnmnnhhieaal 342
                       ********************************************************************************************* PP

              GRAS 215 ............................................desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                                                                    +s  ++  ++++L+++++lsPkv+vvveqe++hn++ +++rf++al+y
  PSME_00057185-RA 343 vekegnvsrakyspseieaaissrrsslgsrksnleaamgimssGSSNGMQ-GIERFLRMLRGLSPKVMVVVEQESNHNGAHLMDRFVDALYY 434
                       *****************************************7754444444.489************************************** PP

              GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                       ysa+fd+le++lp++s er+++E+ l+g++i n+vaceg+er+erhe+l++W +r+++aGF  +pl ++a + a++ll++++sd yr+ +++g
  PSME_00057185-RA 435 YSAMFDCLESTLPQQSIERVTLEKYLFGKQIHNIVACEGSERVERHEKLQQWIKRFDQAGFAHLPLCYTALMHANSLLHTYSSDSYRLLHDNG 527
                       ********************************************************************************************* PP

              GRAS 357 slvlgWkdrpLvsvSaW 373
                       +l+++W++rpL+svSaW
  PSME_00057185-RA 528 CLTICWEERPLYSVSAW 544
                       ***************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.17944525IPR005202Transcription factor GRAS
PfamPF035141.1E-12270544IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MIRADQGSST ALSASTSSGA AAAAAATPPP PLQYFSQLSL ASIRSAILSP LDAGNWWLEE  60
LKSEERGLCL IQLLLACAKY VCSGNMEQTN VCLEQISVLA SLTGDPMQRL ATYFMEGLAA  120
RITKSWPGLH RALNSTHLQP SISDLALARQ VFFSLFPYLK FAFNAVHLTI LESMEKEKVV  180
HIIDLDASEP AQWIPFLQSL SQRPGGPPHL KMTGIAEKKE VLQQTAAILT EEAERLDIPF  240
QFNQLVTRLD HLTDDMLAVK TGDAVAISAV LQFHALLAEE QDFDHNGGGG GGGGGGGGGV  300
GVGSSVPMNR KRPRECSNTV RHNDLILRSM FNMNNHHIEA ALVEKEGNVS RAKYSPSEIE  360
AAISSRRSSL GSRKSNLEAA MGIMSSGSSN GMQGIERFLR MLRGLSPKVM VVVEQESNHN  420
GAHLMDRFVD ALYYYSAMFD CLESTLPQQS IERVTLEKYL FGKQIHNIVA CEGSERVERH  480
EKLQQWIKRF DQAGFAHLPL CYTALMHANS LLHTYSSDSY RLLHDNGCLT ICWEERPLYS  540
VSAWHSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-23705454375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9SWX71e-157A9SWX7_PHYPA; GRS3 GRAS-type protein
TrEMBLI1LIM71e-158I1LIM7_SOYBN; Uncharacterized protein
STRINGGLYMA11G10170.31e-158(Glycine max)
STRINGPP1S130_153V6.11e-157(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.13e-81scarecrow-like 3